Antibodies

View as table Download

Rabbit Polyclonal UBE2S Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501).

Rabbit Polyclonal Antibody against UBE2S (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF.

Rabbit Polyclonal Antibody against UBE2S (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF.

Rabbit Polyclonal Anti-UBE2S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S. Synthetic peptide located within the following region: NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE

Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-UBE2S Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBE2S

UBE2S Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2S

UBE2S Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 122-221 of human UBE2S (NP_055316.2).
Modifications Unmodified

UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated