Antibodies

View as table Download

WDHD1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 830-1129 of human WDHD1 (NP_009017.1).
Modifications Unmodified

WDHD1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 830-1129 of human WDHD1 (NP_009017.1).
Modifications Unmodified

Rabbit Polyclonal Anti-WDHD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDHD1 antibody: synthetic peptide directed towards the C terminal of human WDHD1. Synthetic peptide located within the following region: KRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE

Mouse Monoclonal anti-AND-1 (WDHD1) Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-WDHD1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WDHD1.

WDHD1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDHD1

WDHD1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDHD1