Antibodies

Jump to Filters
View as table Download
ZNF75A Rabbit Polyclonal Antibody
TA341502

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF75A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF75A antibody: synthetic peptide directed towards the N terminal of human ZNF75A. Synthetic peptide located within the following region: FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS
ZNF75A Rabbit Polyclonal Antibody
TA383606

USD 220.00

3 Weeks

ZNF75A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human ZNF75A.