Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
USD 345.00
In Stock
Rabbit polyclonal anti-PA2G6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PA2G6. |
Rabbit Polyclonal c-PLA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 |
USD 379.00
In Stock
CYP1A2 Capture mouse monoclonal antibody, ELISA validated, clone OTI7D12
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700038 |
Goat Anti-ALOX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3. |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505 |
| Modifications | Phospho-specific |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PLA2G6 mouse monoclonal antibody, clone OTI10G4 (formerly 10G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PLA2G6 mouse monoclonal antibody, clone OTI10A2 (formerly 10A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PLA2G2A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI4F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI8G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-AKR1B10 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Rabbit Polyclonal Anti-PLA2G4A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLA2G4A |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-PLA2G6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLA2G6 |
USD 379.00
In Stock
USD 379.00
In Stock
USD 159.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 159.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
USD 379.00
In Stock
Active filters
Category
- Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Pathways
- Linoleic acid metabolism
Availabilities
- In Stock