Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 379.00
In Stock
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK |
Goat Polyclonal Antibody against PI31 / PSMF1 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DHLPPPGYDDMYL, from the C Terminus of the protein sequence according to NP_006805.1; NP_848693.1. |
Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
Rabbit polyclonal anti-PSMC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMC6. |
Rabbit polyclonal anti-PSMD2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PSMD2 |
Anti-PSMD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PSMD11 |
Rabbit Polyclonal Proteasome 19S S3 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the N-Terminus Region |
Carrier-free (BSA/glycerol-free) PSMB9 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PSMA6 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) IFNG mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) IFNG mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFNG mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PSMD3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Active filters
Category
- Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Pathways
- Proteasome
Availabilities
- In Stock