Antibodies

View as table Download

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA

Rabbit Polyclonal Interferon beta Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Rabbit Polyclonal CXCL10/INP10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS