Antibodies

Jump to Filters
View as table Download
Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody
TA346049

USD 475.00

In Stock

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody
TA311804

USD 345.00

In Stock

Rabbit polyclonal Cytochrome P450 2E1 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1.
Modifications Phospho-specific
Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody
TA349845

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2E1