Antibodies

View as table Download

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Rabbit Polyclonal Interferon beta Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Rabbit Polyclonal CXCL10/INP10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS

CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated