Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Interferon beta Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Rabbit Polyclonal CXCL10/INP10 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12B mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12B mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 mouse monoclonal antibody,clone OTI14F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 mouse monoclonal antibody,clone OTI14F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 mouse monoclonal antibody,clone OTI5C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- RIG-I-like receptor signaling pathway
Availabilities
- In Stock