Antibodies

Jump to Filters
View as table Download
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
C1QA Rabbit Polyclonal Antibody
TA342833

USD 375.00

In Stock

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG
Complement C7 (C7) Rabbit Polyclonal Antibody
TA590789

USD 409.00

In Stock

Rabbit Polyclonal Complement C7 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA590791

USD 409.00

In Stock

Rabbit Polyclonal IL1 alpha Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA321162

USD 345.00

In Stock

Anti-IL1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein