USD 380.00
In Stock
Rabbit Polyclonal Anti-CCL4 Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL4 |
USD 380.00
In Stock
Rabbit Polyclonal Anti-CCL4 Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL4 |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free
Applications | FC |
Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free
Reactivities | Human |
Rabbit Polyclonal Interferon beta Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Rabbit Polyclonal CXCL10/INP10 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAVS |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |