Antibodies

Jump to Filters
View as table Download
HOXB5 Rabbit Polyclonal Antibody
TA329288

USD 375.00

In Stock

Rabbit Polyclonal anti-HOXB5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB5 antibody: synthetic peptide directed towards the N terminal of human HOXB5. Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN