Antibodies

Jump to Filters
View as table Download
KIAA1199 (CEMIP) Rabbit Polyclonal Antibody
TA344159

USD 475.00

In Stock

Rabbit Polyclonal Anti-KIAA1199 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA1199 antibody: synthetic peptide directed towards the middle region of human KIAA1199. Synthetic peptide located within the following region: PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD
KIAA1199 (CEMIP) Rabbit Polyclonal Antibody
TA590486

USD 409.00

In Stock

Rabbit Polyclonal KIAA1199 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.