Goat Anti-Sprouty Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPSRGQGKPS, from the C Terminus of the protein sequence according to NP_005832.1; NP_955359.1. |
Goat Anti-Sprouty Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPSRGQGKPS, from the C Terminus of the protein sequence according to NP_005832.1; NP_955359.1. |
Rabbit Polyclonal Anti-SPRY1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPRY1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRY1. Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN |