Antibodies

Jump to Filters
View as table Download
TSG101 Rabbit Polyclonal Antibody
TA343598

USD 310.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
TSG101 Rabbit Polyclonal Antibody
TA333922

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 345.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
SMURF 2 (SMURF2) Mouse Monoclonal Antibody [Clone ID: OTI3E4]
TA806655

USD 379.00

In Stock

SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMURF 2 (SMURF2) Mouse Monoclonal Antibody [Clone ID: OTI3E4]
TA806655S

USD 159.00

2 Days

SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated