Antibodies

Jump to Filters
View as table Download
EPB4IL2 (EPB41L2) Rabbit Polyclonal Antibody
TA313824

USD 345.00

In Stock

Rabbit polyclonal anti-EPB41L2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPB41L2.
EPB4IL2 (EPB41L2) Rabbit Polyclonal Antibody
TA335005

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPB41L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41L2 antibody: synthetic peptide directed towards the middle region of human EPB41L2. Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST
EPB4IL2 (EPB41L2) Goat Polyclonal Antibody
TA303296

USD 375.00

5 Days

Goat Polyclonal Antibody against EPB41L2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RREVRSPTKAPH, from the internal region of the protein sequence according to NP_001422.1.