Rabbit Polyclonal CTCF Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: human CTCF (CCCTC-Binding Factor), using 4 KLH coupled peptides. |
Rabbit Polyclonal CTCF Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: human CTCF (CCCTC-Binding Factor), using 4 KLH coupled peptides. |
Rabbit Polyclonal Anti-CTCF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV |
Rabbit Polyclonal Anti-CTCF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit polyclonal anti-CTCF (Boris) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 14 of rat BORIS |
Rabbit polyclonal anti-CTCF antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CTCF affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of CTCF protein. |
Rabbit Polyclonal anti-CTCF Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CTCF antibody is: synthetic peptide directed towards the C-terminal region of Human CTCF. Synthetic peptide located within the following region: HADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDN |
CTCF Rabbit polyclonal Antibody
Applications | ChIP, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1). |
Modifications | Unmodified |
CTCF Rabbit polyclonal Antibody
Applications | ChIP, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1). |
Modifications | Unmodified |
CTCF Rabbit polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CTCF. |