Antibodies

Jump to Filters
View as table Download
AGAP1 Rabbit Polyclonal Antibody
TA308588

USD 415.00

5 Days

Rabbit polyclonal antibody to CENTG2 (centaurin, gamma 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 795 and 857 of AGAP1 (Uniprot ID#Q9UPQ3)
AGAP1 Rabbit Polyclonal Antibody
TA343187

USD 375.00

5 Days

Rabbit Polyclonal Anti-AGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG
AGAP1 Rabbit Polyclonal Antibody
TA323381

USD 345.00

In Stock

Anti-AGAP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1