Antibodies

Jump to Filters
View as table Download
CDC42EP1 Rabbit Polyclonal Antibody
TA337883

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC42EP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42EP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC42EP1. Synthetic peptide located within the following region: HTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPP
CDC42EP1 Rabbit Polyclonal Antibody
TA362364

USD 360.00

5 Days

CDC42EP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP1