Rabbit Polyclonal Anti-CLEC2D Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLEC2D |
Rabbit Polyclonal Anti-CLEC2D Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLEC2D |
CLEC2D (122-131) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Equine, Human, Monkey |
Immunogen | Synthetic peptide from internal region of human CLEC2D |
Rabbit Polyclonal Anti-CLEC2D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CLEC2D Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC2D. Synthetic peptide located within the following region: GQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRR |
CLEC2D rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CLEC2D |
CLEC2D Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1). |
Modifications | Unmodified |