Antibodies

Jump to Filters
View as table Download
DCBLD1 Rabbit Polyclonal Antibody
TA331410

USD 375.00

5 Days

Rabbit polyclonal Anti-DCBLD1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-DCBLD1 antibody: synthetic peptide directed towards the N terminal of human DCBLD1. Synthetic peptide located within the following region: TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKE
DCBLD1 Rabbit Polyclonal Antibody
TA365725

USD 380.00

4 Weeks

DCBLD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human DCBLD1