DCP1B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 268~298 amino acids from the Central region of Human DCP1B. |
DCP1B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 268~298 amino acids from the Central region of Human DCP1B. |
Rabbit Polyclonal Anti-DCP1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCP1B antibody: synthetic peptide directed towards the N terminal of human DCP1B. Synthetic peptide located within the following region: TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR |
DCP1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCP1B |
DCP1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCP1B |
DCP1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DCP1B. |
Modifications | Unmodified |