Antibodies

View as table Download

Rabbit polyclonal anti-AGPAT9 (MAG1/PLCH) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PLCH.

Rabbit Polyclonal Anti-PLCH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PLCH Antibody: A synthesized peptide derived from human PLCH

Rabbit Polyclonal Anti-Agpat9 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Agpat9 antibody is: synthetic peptide directed towards the middle region of Rat Agpat9. Synthetic peptide located within the following region: HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI

Rabbit Polyclonal Anti-AGPAT9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGPAT9

GPAT3 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated

GPAT3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPAT3