Rabbit Polyclonal LYPD3 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal LYPD3 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
C4.4A / LYPD3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gorilla, Gibbon |
Immunogen | C4.4A / LYPD3 antibody was raised against synthetic 13 amino acid peptide from C-terminus of human LYPD3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Panda (92%); Mouse, Rat, Horse (85%). |
C4.4A / LYPD3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | C4.4A / LYPD3 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human LYPD3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%). |
C4.4A / LYPD3 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Rabbit |
Immunogen | C4.4A / LYPD3 antibody was raised against synthetic 14 amino acid peptide from N-terminus of human LYPD3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Dog, Elephant, Horse, Rabbit (100%); Marmoset, Mouse, Rat, Panda, Pig (93%); Bovine (86%). |
C4.4A / LYPD3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | C4.4A / LYPD3 antibody was raised against synthetic 14 amino acid peptide from internal region of human LYPD3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Rabbit (93%); Marmoset, Dog, Panda, Horse (86%). |
Rabbit Polyclonal Anti-LYPD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYPD3 antibody is: synthetic peptide directed towards the C-terminal region of Human LYPD3. Synthetic peptide located within the following region: SRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCVAPTAGLAALLL |
Rabbit Polyclonal Anti-LYPD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYPD3 antibody is: synthetic peptide directed towards the C-terminal region of Human LYPD3. Synthetic peptide located within the following region: PVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQ |
LYPD3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-326 of human LYPD3 (NP_055215.2). |
Modifications | Unmodified |