Antibodies

Jump to Filters
View as table Download
fast skeletal Myosin (MYLPF) Rabbit Polyclonal Antibody
TA331214

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYLPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
fast skeletal Myosin (MYLPF) Rabbit Polyclonal Antibody
TA392679

USD 285.00

4 Weeks

MYLPF (phospho-S16) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human MYLPF around the phosphorylation site of Serine 16.