Antibodies

Jump to Filters
View as table Download
NLN Rabbit Polyclonal Antibody
TA343287

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLN antibody is: synthetic peptide directed towards the N-terminal region of NLN. Synthetic peptide located within the following region: CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS
NLN Rabbit Polyclonal Antibody
TA379154

USD 220.00

3 Weeks

NLN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 38-260 of human NLN (NP_065777.1).
Modifications Unmodified