Antibodies

View as table Download

OR8D4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 279-308 amino acids from the C-terminal region of human Olfactory receptor 8D4

Rabbit Polyclonal Anti-OR8D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D4. Synthetic peptide located within the following region: LKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNALMKLLRRKI