Antibodies

Jump to Filters
View as table Download
P2rx5 Rabbit Polyclonal Antibody
TA328995

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2X5 Receptor

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RENAIVNVKQSQILHPVKT, corresponding to amino acid residues 437-455 of? rat P2X5 Receptor. Intracellular, C-terminus.
P2X5 (P2RX5) Rabbit Polyclonal Antibody
TA338778

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX5 antibody: synthetic peptide directed towards the N terminal of human P2RX5. Synthetic peptide located within the following region: LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR
P2X5 (P2RX5) Rabbit Polyclonal Antibody
TA379550

USD 220.00

3 Weeks

P2RX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2).
Modifications Unmodified