Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PCDH15 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-PCDH15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCDH15 antibody: synthetic peptide directed towards the N terminal of human PCDH15. Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP |
PCDH15 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-400 of human PCDH15 (NP_001136235.1). |
| Modifications | Unmodified |