Rabbit polyclonal Anti-PPP3R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ |
PPP3R1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
PPP3R1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
