Antibodies

Jump to Filters
View as table Download
RHOJ Rabbit Polyclonal Antibody
TA344772

USD 475.00

5 Days

Rabbit Polyclonal Anti-RHOJ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOJ antibody: synthetic peptide directed towards the middle region of human RHOJ. Synthetic peptide located within the following region: LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
RHOJ (Center) Rabbit Polyclonal Antibody
AP53662PU-N

USD 450.00

2 Weeks

RHOJ (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human