Antibodies

View as table Download

Rabbit Polyclonal Anti-SUMF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUMF1 antibody is: synthetic peptide directed towards the N-terminal region of Human SUMF1. Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT

SUMF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 310~339 amino acids from the C-terminal region of Human SUMF1

Goat Anti-SUMF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETLNPKGPPSGKDR, from the internal region of the protein sequence according to NP_877437.2.

SUMF1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

SUMF1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SUMF1

SUMF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-374 of human SUMF1 (NP_877437.2).
Modifications Unmodified

SUMF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-374 of human SUMF1 (NP_877437.2).
Modifications Unmodified