SPATIAL (TBATA) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human C10orf27 |
SPATIAL (TBATA) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human C10orf27 |
Rabbit Polyclonal Anti-TBATA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TBATA Antibody is: synthetic peptide directed towards the C-terminal region of Human TBATA. Synthetic peptide located within the following region: EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES |