Rabbit Polyclonal Anti-ZIC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZIC4 antibody: synthetic peptide directed towards the N terminal of human ZIC4. Synthetic peptide located within the following region: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEP |
Rabbit Polyclonal Anti-ZIC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZIC4 antibody: synthetic peptide directed towards the middle region of human ZIC4. Synthetic peptide located within the following region: RKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS |
Rabbit Polyclonal Antibody against ZIC4 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZIC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 299-334 amino acids from the C-terminal region of human ZIC4. |
ZIC4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZIC4 |
Germany
Japan
United Kingdom
China