Antibodies

View as table Download

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYLK3