Rabbit anti-SERPINF1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINF1 |
Rabbit anti-SERPINF1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINF1 |
Rabbit Polyclonal Anti-SERPINF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN |
Goat Anti-SERPINF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KITGKPIKLTQVEHR, from the internal region of the protein sequence according to NP_002606.3. |
Carrier-free (BSA/glycerol-free) SERPINF1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-SERPINF1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
Anti-SERPINF1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |