Antibodies

Jump to Filters
View as table Download
PEDF (SERPINF1) Rabbit Polyclonal Antibody
TA327134

USD 275.00

3 Weeks

Rabbit anti-SERPINF1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINF1
PEDF (SERPINF1) Rabbit Polyclonal Antibody
TA330022

USD 375.00

5 Days

Rabbit Polyclonal Anti-SERPINF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
PEDF (SERPINF1) Goat Polyclonal Antibody
TA334193

USD 375.00

5 Days

Goat Anti-SERPINF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KITGKPIKLTQVEHR, from the internal region of the protein sequence according to NP_002606.3.
PEDF (SERPINF1) Mouse Monoclonal Antibody [Clone ID: OTI1F7]
CF504434

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINF1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
PEDF (SERPINF1) Rabbit Polyclonal Antibody
TA321509

USD 345.00

4 Weeks

Anti-SERPINF1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
PEDF (SERPINF1) Rabbit Polyclonal Antibody
TA321510

USD 345.00

In Stock

Anti-SERPINF1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
PEDF (SERPINF1) Mouse Monoclonal Antibody [Clone ID: OTI1F7]
TA504434

USD 379.00

In Stock

SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
PEDF (SERPINF1) Mouse Monoclonal Antibody [Clone ID: OTI1F7]
TA504434S

USD 159.00

2 Days

SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated