Antibodies

Jump to Filters
View as table Download
ACVRL1 Rabbit Polyclonal Antibody
TA311718

USD 345.00

In Stock

Rabbit polyclonal anti-ACVL1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACVL1.
ACVRL1 Rabbit Polyclonal Antibody
TA371656

USD 380.00

4 Weeks

ACVRL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACVRL1
ACVRL1 Rabbit Polyclonal Antibody
TA334641

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACVRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH
ACVRL1 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
CF809560

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACVRL1 Rabbit Polyclonal Antibody
TA367428

USD 380.00

4 Weeks

ACVRL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACVRL1
ACVRL1 Rabbit Polyclonal Antibody
TA373243

USD 275.00

3 Weeks

ACVRL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACVRL1
Modifications Unmodified
ACVRL1 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
TA809560

USD 379.00

In Stock

ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated