Antibodies

View as table Download

Rabbit Polyclonal Anti-BOLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BOLL antibody: synthetic peptide directed towards the N terminal of human BOLL. Synthetic peptide located within the following region: GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ

Goat Anti-BOULE / BOLL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QPEPIKTVWSIHY, from the C Terminus of the protein sequence according to NP_932074.1; NP_149019.1.

Carrier-free (BSA/glycerol-free) BOLL mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) BOLL mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BOLL Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Purified BOLL mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified BOLL mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BOLL mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

BOLL mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Purified BOLL mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated