Rabbit Polyclonal Anti-BTN2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTN2A1 antibody: synthetic peptide directed towards the N terminal of human BTN2A1. Synthetic peptide located within the following region: SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH |
BTN2A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BTN2A1 |
BTN2A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-240 of human BTN2A1 (NP_510961.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
