Germany
Japan
United Kingdom
China
Rabbit Polyclonal Dact3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Dact3 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Dact3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DACT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the C-terminal region of Human DACT3. Synthetic peptide located within the following region: AAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAE |
Rabbit Polyclonal Anti-DACT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the middle region of Human DACT3. Synthetic peptide located within the following region: ALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSARPARE |
DACT3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DACT3 |