Antibodies

View as table Download

Rabbit polyclonal anti-DLX3 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DLX3.

Rabbit polyclonal anti-COX7S/A2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX7S/A2.

Rabbit Polyclonal Anti-DLX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 Antibody: A synthesized peptide derived from human DLX3

Rabbit Polyclonal Anti-DLX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT

Rabbit Polyclonal anti-DLX3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVN

Rabbit Polyclonal Anti-DLX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the C terminal of human DLX3. Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

DLX3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DLX3 (NP_005211.1).
Modifications Unmodified