Antibodies

View as table Download

Rabbit Polyclonal Anti-HMGB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3. Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE

Goat Anti-HMGB3 / HMG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KFDGAKGPAKVARKK, from the internal region (near C Terminus) of the protein sequence according to NP_005333.2.

Rabbit Polyclonal Anti-HMGB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3. Synthetic peptide located within the following region: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWK

Anti-HMGB3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 164-178 amino acids of Human high mobility group box 3

Anti-HMGB3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 164-178 amino acids of Human high mobility group box 3

HMGB3 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse HMGB3

HMGB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB3 (NP_005333.2).
Modifications Unmodified