Antibodies

View as table Download

Goat Anti-LARGE (aa421-433) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SEADVNSENLQKQ, from the internal region of the protein sequence according to NP_004728.1.

Rabbit Polyclonal Anti-LARGE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LARGE antibody: synthetic peptide directed towards the middle region of human LARGE. Synthetic peptide located within the following region: AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE