Rabbit Polyclonal Anti-OSGIN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSGIN2 antibody: synthetic peptide directed towards the C terminal of human OSGIN2. Synthetic peptide located within the following region: ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG |
Carrier-free (BSA/glycerol-free) OSGIN2 mouse monoclonal antibody,clone OTI5F6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) OSGIN2 mouse monoclonal antibody,clone OTI1C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
OSGIN2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OSGIN2 |
OSGIN2 mouse monoclonal antibody,clone OTI5F6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
OSGIN2 mouse monoclonal antibody,clone OTI5F6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
OSGIN2 mouse monoclonal antibody,clone OTI1C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
OSGIN2 mouse monoclonal antibody,clone OTI1C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
