Antibodies

View as table Download

Rabbit Polyclonal Anti-PDIK1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

Rabbit Polyclonal Anti-PDIK1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE

Carrier-free (BSA/glycerol-free) PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated