Goat Polyclonal Antibody against PRDM4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CSAVYSADESLSAHK, from the C Terminus of the protein sequence according to NP_036538. |
Goat Polyclonal Antibody against PRDM4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CSAVYSADESLSAHK, from the C Terminus of the protein sequence according to NP_036538. |
Rabbit Polyclonal anti-Prdm4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS |
Rabbit Polyclonal Anti-PRDM4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM4 antibody: synthetic peptide directed towards the C terminal of human PRDM4. Synthetic peptide located within the following region: GPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK |
Recombinant Anti-PRDM4 (Clone RAB-C367)
Applications | ChIP, ELISA, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |