Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PKA regulatory subunit I beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAP1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRKAR1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B. Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT |
Anti-PRKAR1B rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 50-62 amino acids of Human protein kinase, cAMP-dependent, regulatory, type I, beta |
Anti-PRKAR1B Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 50-62 amino acids of Human protein kinase, cAMP-dependent, regulatory, type I, beta |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Category
- Antibodies
Target Symbol
- PRKAR1B
Families
- Druggable Genome
Pathways
- Apoptosis