Antibodies

View as table Download

Rabbit polyclonal anti-AASS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human AASS.

AASS (C-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 812-841 amino acids from the C-terminal region of human AASS.

Rabbit Polyclonal Anti-AASS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASS antibody is: synthetic peptide directed towards the C-terminal region of Human AASS. Synthetic peptide located within the following region: HHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTP