Antibodies

Jump to Filters
View as table Download
ACVRL1 Rabbit Polyclonal Antibody
TA311718

USD 345.00

In Stock

Rabbit polyclonal anti-ACVL1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACVL1.
ACVRL1 (C-term) Goat Polyclonal Antibody
AP31557PU-N

USD 375.00

5 Days

ACVRL1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Peptide with sequence C-KISNSPEKPKVIQ, from the C Terminus of the protein sequence according to NP_000011.2; NP_001070869.1.
ACVRL1 Rabbit Polyclonal Antibody
TA334641

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACVRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH
ACVRL1 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
CF809560

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACVRL1 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
TA809560

USD 379.00

In Stock

ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated