Antibodies

Jump to Filters
View as table Download
CCN1 (CYR61) Rabbit Polyclonal Antibody
TA329157

USD 310.00

5 Days

Rabbit Polyclonal Anti-CYR61 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYR61 antibody is: synthetic peptide directed towards the middle region of Human CYR61. Synthetic peptide located within the following region: CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPR
CCN1 (CYR61) Rabbit Polyclonal Antibody
TA349858

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYR61 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CYR61